30-MINUTE MEALS! Get the email series now
Galovi Cooking

Air Fryer Parmesan Crusted Chicken

5 from 1 vote
1 Comments
Ava
By: AvaUpdated: Jan 16, 2026
This post may contain affiliate links. Please read our disclosure policy.

A quick, family-friendly chicken with a crunchy Parmesan crust made in the air fryer — juicy inside, golden and crisp outside, ready in under 30 minutes.

Air Fryer Parmesan Crusted Chicken

This Air Fryer Parmesan Crusted Chicken became a weeknight hero in my kitchen the moment I discovered how quickly the air fryer could transform thin chicken cutlets into something that tastes like it came from a bistro. I first made this during a busy week when I needed dinner that felt special but could be executed between calls and after-school pickups. The result was a crunchy, savory crust that held onto moisture and left everyone at the table asking for seconds. What makes this version stand out is the blend of finely grated Parmesan and seasoned breadcrumbs — they brown beautifully in the high circulating heat of the air fryer and deliver that irresistible snap with every bite.

I love how forgiving this technique is. Even when I use chicken breasts I pound them gently so they cook evenly without drying out. The crusting method gives texture and umami from the cheese while the simple lemon finish brightens each bite. Over time I've tweaked the seasoning, adjusted breading ratios, and learned a few tricks to keep the crust attached and crisp. This is a formula that works whether I’m feeding kids, entertaining, or packing protein-forward lunches. It’s quick, adaptable, and reliably delicious.

Why You'll Love This Recipe

  • Ready in about 30 minutes from start to finish — perfect for weeknights when time is limited but you want a satisfying, homemade meal.
  • Uses pantry staples: grated Parmesan, plain breadcrumbs, eggs, lemon, and dried herbs — no specialty shopping required.
  • Air fryer produces a golden, crunchy crust with less oil than pan-frying, making it lighter yet still indulgent.
  • Make-ahead options: bread the cutlets and refrigerate for up to 24 hours, or freeze before frying for easy future meals.
  • Flexible for dietary tweaks—swap breadcrumbs for panko, gluten-free crumbs, or almond flour for low-carb versions.
  • Family-friendly texture and flavor profile — kids love the crisp exterior, adults appreciate the bright lemon finish.

In my family, this dish quickly became an every-other-week staple. My partner always reaches for the lemon wedges, while our youngest insists on extra grated Parmesan at the table. The first time I made a double batch for a potluck, someone asked for the recipe on the spot — that’s how I know it’s a keeper.

Ingredients

  • Chicken: 1 1/2 pounds boneless, skinless chicken breasts (about 3 medium) — choose even-sized breasts and halve or butterfly if large so cutlets cook uniformly. I prefer organic or free-range when available for flavor and texture.
  • Parmesan: 1 cup finely grated Parmesan cheese — use a real Parmigiano-Reggiano or high-quality domestic Parmesan, not pre-shredded blends; the fine grate binds better and browns beautifully.
  • Breadcrumbs: 1 cup plain breadcrumbs or panko — panko yields a lighter, crunchier crust while regular breadcrumbs give tighter adherence. For gluten-free, choose certified gluten-free crumbs.
  • Egg wash: 2 large eggs beaten with 2 tablespoons water — the wet layer that helps the crust stick and promotes even browning.
  • Seasonings: 1 teaspoon garlic powder, 1 teaspoon onion powder, 1 teaspoon dried Italian seasoning, 1/2 teaspoon smoked paprika, 1/2 teaspoon salt, and 1/2 teaspoon black pepper — adjust salt to taste.
  • Finish: 1 lemon, cut into wedges for squeezing over hot cutlets and 2 tablespoons melted butter or olive oil for added gloss and flavor (optional).

Instructions

Prepare the chicken: Pound each chicken breast to an even 1/2-inch thickness using a meat mallet or rolling pin inside a zip-top bag. This ensures even cooking and prevents the thin edges from drying out while the center finishes. Pat the cutlets dry with paper towels and season both sides lightly with salt and pepper; allow them to rest at room temperature for 5-10 minutes while you set up the coating stations. Make the dry mix: In a shallow bowl combine the finely grated Parmesan, breadcrumbs, garlic powder, onion powder, dried Italian seasoning, smoked paprika, and black pepper. Stir well so the cheese and seasonings are evenly distributed. The finely grated cheese acts as both flavor and binder; avoid coarse shreds that won't integrate well. Set up the wet station: In a second shallow bowl beat the eggs with 2 tablespoons of water until smooth. The water thins the egg slightly so the coating spreads more evenly and prevents excessive clumping of crumbs on the surface. Coat the chicken: Dip each cutlet first into the egg wash, allowing excess to drip off, then press firmly into the breadcrumb-Parmesan mixture on both sides. Use your hands to compact the crust gently so it adheres — a light press creates a uniform layer that browns consistently. If you notice loose crumbs, press again or let the coated cutlets rest on a wire rack for 5 minutes to set the crust. Preheat and air fry: Preheat the air fryer to 400°F (200°C) for 3-5 minutes. Lightly brush or spray the air fryer basket with oil to prevent sticking. Place the cutlets in a single layer without overlapping; work in batches if needed. Air fry at 400°F for 8-10 minutes, flipping halfway through, until the crust is golden and the internal temperature reaches 165°F (74°C). Thin cutlets will be on the lower end of the time range; thicker pieces may need an extra minute or two. Rest and finish: Transfer the cooked cutlets to a plate and let rest for 3-5 minutes — this lets juices redistribute and helps the crust firm up. Finish with a squeeze of lemon and a light brush of melted butter or olive oil if desired. Serve immediately with your chosen sides. User provided content image 1

You Must Know

  • High in protein and moderate in fat — each cutlet provides satisfying protein to keep you full for hours.
  • Stores well: refrigerate cooked cutlets in an airtight container for up to 3 days or freeze for up to 3 months; reheat in the air fryer at 350°F for 6-8 minutes.
  • Because the coating contains Parmesan and breadcrumbs, this version is not dairy-free or gluten-free unless substitutions are made.
  • Air fryers vary: check internal temperature rather than relying solely on time to avoid overcooking.

My favorite part is the contrast between the crisp crust and the juicy interior; that first cut into a warm cutlet is always the loudest compliment at my table. I once brought these to a small gathering and they disappeared within ten minutes — an easy way to win over a crowd without a lot of fuss.

Storage Tips

Store cooked cutlets in an airtight container in the refrigerator for up to 3 days. If you want to preserve longer, freeze single layers separated by parchment paper in a freezer-safe bag for up to 3 months. To reheat, thaw overnight in the fridge and refresh in the air fryer at 350°F for 6-8 minutes until heated through and the crust has regained crispness. Avoid microwaving, which will make the crust soggy; if you must microwave, follow with a brief air-fry to restore texture.

User provided content image 2

Ingredient Substitutions

Want to adapt this to dietary needs? Use gluten-free panko or crushed gluten-free crackers instead of regular breadcrumbs for a gluten-free version, and choose dairy-free grated alternatives or nutritional yeast with extra olive oil to mimic richness if avoiding dairy (note the texture will change). For a lower-carb option, substitute finely ground almond flour mixed with grated Parmesan or skip Parmesan and use crushed pork rinds for a crispy, low-carb crust. To make this spicier, add 1/4 teaspoon cayenne or chili flakes to the dry mix.

Serving Suggestions

Serve with a crisp green salad dressed in lemon vinaigrette, roasted baby potatoes, or sautéed green beans for a balanced plate. For a lighter pairing, place the cutlet atop mixed greens and shaved fennel for an elegant salad. Sprinkle extra Parmesan, chopped parsley, and lemon zest at the table to enhance freshness and presentation. These cutlets also work beautifully on sandwiches with arugula and a smear of garlic mayo.

Cultural Background

The idea of crusted poultry draws from pan-fried European traditions — combining cheese and breadcrumbs is classic in Italian cooking where cheese serves both flavor and binding roles. This air fryer adaptation channels those flavors into modern cookware, preserving the essence of a crisp, cheesy exterior while cutting down on oil. It’s a contemporary, health-aware twist on time-honored techniques.

Seasonal Adaptations

In spring and summer, top the cutlets with a quick tomato-caper relish or serve alongside grilled asparagus. Autumn calls for roasted root vegetable sides and a sage-butter finish. For holiday dinners, increase herbs to include rosemary and thyme and serve with a mustard cream on the side for a festive touch.

Meal Prep Tips

For meal prep, bread the cutlets and place them on a tray covered with plastic wrap in the refrigerator for up to 24 hours; air fry straight from chilled for dinner. Alternatively, flash-cook the cutlets for 4-5 minutes in the air fryer, cool, and freeze; finish cooking from frozen for convenient future meals. Portion into meal prep containers with roasted vegetables and keep lemon wedges separate to preserve freshness.

Every time I prepare this, it reminds me of the simple satisfaction of a well-executed dish that never feels repetitive. The method is reliable, the flavors are familiar, and the convenience of the air fryer keeps this in my regular rotation. I hope it becomes a go-to for you and your family too.

Pro Tips

  • Pound breasts to an even thickness so they cook through without drying.

  • Use finely grated Parmesan (not pre-shredded) for best adhesion and browning.

  • Let breaded cutlets rest 5 minutes before air frying to help the crust set.

This nourishing air fryer parmesan crusted chicken recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I bread the chicken ahead of time?

Yes. After breading, place cutlets on a tray, cover tightly, and refrigerate for up to 24 hours before air frying.

How do I know when the chicken is done?

Check that the internal temperature reaches 165°F (74°C) using a digital thermometer inserted into the thickest part of the cutlet.

What's the best way to reheat leftovers?

Reheat in the air fryer at 350°F for 6-8 minutes to restore crispiness; avoid microwaving alone.

Tags

Air Fryer Recipesair fryerchickenparmesanrecipeweeknight dinnercrispy chicken
No ratings yet

Air Fryer Parmesan Crusted Chicken

This Air Fryer Parmesan Crusted Chicken recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Air Fryer Parmesan Crusted Chicken
Prep:15 minutes
Cook:12 minutes
Rest Time:10 mins
Total:27 minutes

Ingredients

Chicken

Breading

Wet mix

Seasonings & finish

Instructions

1

Prep the chicken

Pound breasts to an even 1/2-inch thickness, pat dry, and season lightly with salt and pepper. Rest briefly while preparing coatings.

2

Make the dry mix

Combine finely grated Parmesan, breadcrumbs, and seasonings in a shallow bowl, mixing until uniform.

3

Set up wet station

Beat eggs with 2 tablespoons water in a separate shallow bowl to create an even egg wash for adhesion.

4

Coat the cutlets

Dip each cutlet in the egg wash, then press into the Parmesan-breadcrumb mixture on both sides. Let rest on a rack for 5 minutes to set.

5

Air fry

Preheat air fryer to 400°F. Arrange cutlets in a single layer and air fry for 8-10 minutes, flipping halfway, until the internal temperature reaches 165°F.

6

Rest and serve

Let cooked cutlets rest 3-5 minutes, finish with lemon and optional butter, and serve immediately.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 450kcal | Carbohydrates: 18g | Protein:
41g | Fat: 22g | Saturated Fat: 7g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
9g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@galovicooking on social media!

Air Fryer Parmesan Crusted Chicken

Categories:

Air Fryer Parmesan Crusted Chicken

Did You Make This?

Leave a comment & rating below or tag @galovicooking on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Ava!

Chef and recipe creator specializing in delicious Air Fryer Recipes cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.